PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla015875
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family BBR-BPC
Protein Properties Length: 313aa    MW: 35007.7 Da    PI: 10.135
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla015875genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind366.64.7e-11213131301
  GAGA_bind   1 mdddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkll 82 
                mdd  ++e  r+k  y++              ++ ++l   +++++ms+iaerda+irernlalsek++a+a+rd+a+ qrd+ala+r+ al+erdn+l+
  Cla015875   1 MDDGRQHEngRHKLdYFRggpspwnmvpphhvKEpNALV--MNKKIMSIIAERDAAIRERNLALSEKNDALAARDEALRQRDEALAQRDSALMERDNALA 98 
                666655555788877888999999999876663335666..99********************************************************* PP

  GAGA_bind  83 alllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkk.ksekskkkvkke 181
                al+ ++n+  s+ p g ++ ++tk +++l + + p+++++++++++ ++++a+pi+  a+ea ++++ k+ + +k+  +k++k ++k  +e+ +++ +++
  Cla015875  99 ALEIRDNA--SNFPLGGGIQRKTKRLHHLSN-HMPNMSETPYGTKDVHITDAFPITVIASEAVKSQQGKRIKDNKSVSSKTSKLPRKkVGEDLNRHAATD 195
                ****9998..7789999**********9998.78**********************************99999999988888855540456666666666 PP

  GAGA_bind 182 saderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsn 281
                +  ++ +++++ +d++ln +s+D+s++P+P+CsCtG  rqCYkWGnGGWqS+CCtt +S+yPLP ++++r+aR++grKmS+++f+klL++Laa G+dls 
  Cla015875 196 G--TKYRTDWDGQDVGLNLISFDDSSMPAPICSCTGLARQCYKWGNGGWQSSCCTTHMSMYPLPHMPNKRHARMGGRKMSGSVFTKLLSRLAAAGHDLSV 293
                6..68*********************************************************************************************** PP

  GAGA_bind 282 pvDLkdhWAkHGtnkfvtir 301
                pvDLkdhWA+HGtn+++tir
  Cla015875 294 PVDLKDHWARHGTNRYITIR 313
                *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.0E-1441313IPR010409GAGA-binding transcriptional activator
PfamPF062178.3E-991313IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MDDGRQHENG RHKLDYFRGG PSPWNMVPPH HVKEPNALVM NKKIMSIIAE RDAAIRERNL  60
ALSEKNDALA ARDEALRQRD EALAQRDSAL MERDNALAAL EIRDNASNFP LGGGIQRKTK  120
RLHHLSNHMP NMSETPYGTK DVHITDAFPI TVIASEAVKS QQGKRIKDNK SVSSKTSKLP  180
RKKVGEDLNR HAATDGTKYR TDWDGQDVGL NLISFDDSSM PAPICSCTGL ARQCYKWGNG  240
GWQSSCCTTH MSMYPLPHMP NKRHARMGGR KMSGSVFTKL LSRLAAAGHD LSVPVDLKDH  300
WARHGTNRYI TIR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817980.0LN681798.1 Cucumis melo genomic scaffold, anchoredscaffold00019.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448032.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448033.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448034.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448035.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448036.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448037.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448038.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448039.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C61e-134BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A0A0K1470.0A0A0A0K147_CUCSA; Uncharacterized protein
STRINGGLYMA05G38430.21e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-135basic pentacysteine 4